PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0058s0549.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family Trihelix
Protein Properties Length: 689aa    MW: 74545.3 Da    PI: 9.5461
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0058s0549.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.81.6e-2971155187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW++qe+ aL+++r+em++++r++ lk+plWeevs+k+ e g+ rs k+Ckek+en++k+yk++keg+ +r  ++ +t+++f++lea
  Kaladp0058s0549.1.p  71 RWPRQETVALLKIRSEMDSAFRDATLKGPLWEEVSRKLGELGYVRSGKKCKEKFENVHKYYKRTKEGRAGR--QDGKTYRFFTHLEA 155
                          8********************************************************************98..56667******985 PP

2trihelix107.11.2e-33504589187
             trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                          rW+k evlaLi++r+++e+r++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf++l+a
  Kaladp0058s0549.1.p 504 RWPKVEVLALIKLRSNLENRYQEAGPKGPLWEEISAGMRQMGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFNELDA 589
                          8*********************************************************************8.99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.7664128IPR017877Myb-like domain
SMARTSM007170.005168130IPR001005SANT/Myb domain
PfamPF138373.1E-1970156No hitNo description
CDDcd122034.51E-2870135No hitNo description
PROSITE profilePS500907.166497561IPR017877Myb-like domain
SMARTSM007170.0026501563IPR001005SANT/Myb domain
PfamPF138371.7E-23503590No hitNo description
CDDcd122031.94E-30503568No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MQQQQQGSQY GGVSPDLGSA PRTQMLAAGG GGSEQAEAAS PISSRPPASI MNFDDLVDDT  60
DRAGSTSSGN RWPRQETVAL LKIRSEMDSA FRDATLKGPL WEEVSRKLGE LGYVRSGKKC  120
KEKFENVHKY YKRTKEGRAG RQDGKTYRFF THLEALQAVT ASGSGSGSTN LIPSAATPPP  180
PPLLMTSSGP PAAAASPLRN MQFATPVSVG IGGNIVMQMA GVAPPSQPFT MYSRDLSMGA  240
GVSVPGSMSA AAPVGISFSS GSSSSGSYDS DEDEEEVDDV SEEERPSSTP VGSGQKRKRG  300
YSFSSRGGGG TKRRMMDFFE GLMKQVMQKQ EAMQQRFLEA IAKREQDRMM REEAWKRQEA  360
ARLSREQELM VQERATAASR DAAIVSFLQK ITGQTIRLPQ PVSHQNVAVT PAAPPPSVPT  420
MPPAAPASIP SSTSPPSRQQ FQQKQHKSQQ QKQQPQNTDL VRQHQMPPPP STEAIMAVPE  480
RQIPPQDPPC GEGGGSYSEA ASSRWPKVEV LALIKLRSNL ENRYQEAGPK GPLWEEISAG  540
MRQMGYSRSS KRCKEKWENI NKYFKKVKES NKKRPEDAKT CPYFNELDAL YQKKILSGAY  600
SGSSSIIVPF QQQQQPQQGL SVDQSKNQET SISNVGVVQT SAAAQVESAD KRDGTDLEQP  660
NNGGLPDSIF EDQGGNAGAT GGSRKRTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011470851.10.0PREDICTED: trihelix transcription factor GTL1 isoform X2
TrEMBLA0A061G1Q90.0A0A061G1Q9_THECC; Duplicated homeodomain-like superfamily protein, putative isoform 2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.17e-47Trihelix family protein